Cagrilintide / Semaglutide Blend

Description

Product Specifications

Form: Lyophilized dual-peptide powder

Strength: Add the product-specific Cagrilintide / Semaglutide strength

Compound Classification: Dual modified peptide research formulation

Components: Cagrilintide and Semaglutide

Combined Peptide Length: Not applicable as a single value because the formulation contains two independent modified peptide molecules

Combined Molecular Formula: Not applicable as a single value

Combined Molecular Weight: Not applicable as a single value

Blend CAS Number: No single CAS number applies to the complete formulation

Purity: Individual component purity should be ≥99%, where confirmed through batch-specific HPLC analysis

Appearance: White to off-white lyophilized peptide powder

Intended Use: Laboratory research and analytical applications only

Cagrilintide Component

Alternate Names: AM833, NN0174-0833

Modified Chain Length: 38 residues when the N-terminal γ-Glu linker residue is included

Amylin-Derived Peptide Portion: 37 amino acid residues

Peptide Classification: Synthetic lipidated amylin analog research peptide

Modified Sequence: (Eicosanedioic acid-γ-Glu)-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Glu-Phe-Leu-Arg-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Pro-NH₂

Short Sequence: (Eicosanedioic acid-γ-Glu)-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH₂

Structural Modification: Intramolecular disulfide bridge between the two cysteine residues

Lipid Modification: N-terminal γ-glutamyl residue acylated with eicosanedioic acid

C-Terminal Modification: Amidated

Molecular Formula: C₁₉₄H₃₁₂N₅₄O₅₉S₂ for the defined parent structure

Molecular Weight: Approximately 4409 g/mol

CAS Number: 1415456-99-3

PubChem confirms the formula, molecular weight, CAS number, and modified 38-residue representation, while Cayman Chemical documents the detailed lipidated sequence and disulfide-linked architecture.

Semaglutide Component

Peptide Length: 31 amino acid residues

Peptide Classification: Synthetic modified GLP-1 analog lipopeptide

Peptide Sequence: His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys*-Glu-Phe-Ile-Ala-Trp-Leu-Val-Arg-Gly-Arg-Gly

Structural Modifications: Aib substitution at position 8, Arg substitution at position 34, and modification of Lys26

Lipid Modification: Lys26 linked through a hydrophilic spacer to a C18 fatty di-acid

C-Terminal Modification: Free carboxyl terminus

Molecular Formula: C₁₈₇H₂₉₁N₄₅O₅₉

Molecular Weight: Approximately 4113.58 g/mol

CAS Number: 910463-68-2

FDA documentation confirms Semaglutide's molecular formula, molecular weight, Aib8 modification, Lys26 lipidation, and position-34 modification.

Research Applications

Analytical characterization using HPLC, UPLC, and LC-MS workflows

Independent identification and quantification of Cagrilintide and Semaglutide

Chromatographic separation of individual blend components

In vitro characterization of amylin-related and GLP-1 receptor-associated molecular interactions

Comparative analysis of two structurally distinct lipidated peptide architectures

Structure-activity evaluation of modified peptide analogs

Assessment of disulfide-bond integrity within the Cagrilintide component

Characterization of lipid-linked modifications within both peptide components

Evaluation of component identity, purity, molecular weight, and structural integrity

Assessment of formulation homogeneity and component compatibility

Stability profiling under controlled temperature, pH, buffer, and storage conditions

Quality Documentation

A batch-specific Certificate of Analysis and applicable analytical documentation should be available for each lot. Documentation should independently verify the identity and quantity of Cagrilintide and Semaglutide together with individual purity, molecular mass, structural modifications, formulation ratio, counterion status, and batch information.

Cagrilintide may be supplied with variable acetate content, while Semaglutide may likewise be present in different formulated or counterion-containing preparations. These factors can influence the reported composition of the finished material.

Because Cagrilintide / Semaglutide Blend contains two independent molecular entities, a single molecular formula, molecular weight, sequence, or CAS number should not be assigned to the complete blend. Batch-specific HPLC and mass-spectrometric documentation should be used as the final reference for analytical specifications.

For Laboratory Research Use Only

This product is intended exclusively for controlled laboratory and in vitro research. Not for human or veterinary use. Not for diagnostic, therapeutic, clinical, cosmetic, or household applications.