Cagrilintide

Description

Product Specifications

Form: Lyophilized peptide powder

Strength: Add the product-specific strength

Modified Chain Length: 38 amino acid residues when the N-terminal γ-Glu linker residue is included

Amylin-Derived Peptide Portion: 37 amino acid residues

Peptide Classification: Synthetic lipidated long-acting amylin analog research peptide

Modified Peptide Sequence: (Eicosanedioic acid-γ-Glu)-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Glu-Phe-Leu-Arg-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Pro-NH₂

Short Sequence: (Eicosanedioic acid-γ-Glu)-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH₂

Structural Modification: Intramolecular disulfide bridge between Cys³ and Cys⁸ when the N-terminal γ-Glu residue is included in residue numbering

Equivalent Amylin-Backbone Numbering: Cys²-Cys⁷ disulfide bridge within the 37-residue peptide portion

Lipid Modification: N-terminal γ-glutamyl linker acylated with eicosanedioic acid

C-Terminal Modification: Amidated

Molecular Formula: C₁₉₄H₃₁₂N₅₄O₅₉S₂ for the defined parent structure

Molecular Weight: Approximately 4409.0 g/mol

CAS Number: 1415456-99-3

Purity: ≥99%, where confirmed through batch-specific HPLC analysis

Appearance: White to off-white peptide powder

Intended Use: Laboratory research and analytical applications only

Research Applications

Analytical characterization using HPLC, UPLC, and LC-MS workflows

In vitro investigation of amylin receptor-binding behavior

Evaluation of interactions involving AMY₁R, AMY₂R, AMY₃R, and calcitonin receptor systems

Investigation of receptor-associated intracellular signaling under controlled assay conditions

Structure-activity analysis of modified amylin analogs

Characterization of lipidated peptide architecture and side-chain modifications

Evaluation of disulfide-bond integrity using suitable analytical techniques

Peptide identity, purity, molecular weight, and structural integrity analysis

Comparative assessment of Cagrilintide and related amylin-derived research peptides

Stability profiling under controlled temperature, pH, buffer, and storage conditions

Quality Documentation

A batch-specific Certificate of Analysis and applicable analytical documentation should be available for each lot. Verify peptide identity, exact modified sequence, disulfide configuration, N-terminal lipid modification, C-terminal amidation, purity, molecular weight, counterion content, formulation details, and batch information against the records supplied with the individual product.

Cagrilintide is a structurally modified peptide and should not be represented solely by its unmodified amino acid backbone. The defined molecular identity includes the N-terminal eicosanedioic acid-γ-Glu modification, disulfide bridge, and C-terminal amide.

Acetate-containing Cagrilintide preparations may be reported as C₁₉₄H₃₁₂N₅₄O₅₉S₂·xC₂H₄O₂, with variable acetate content. Cayman Chemical lists Cagrilintide acetate using this variable-counterion representation while reporting 4409.1 as the parent peptide formula weight. Batch-specific HPLC and mass-spectrometric documentation should therefore be used as the final reference for analytical specifications.

For Laboratory Research Use Only

This product is intended exclusively for controlled laboratory and in vitro research. Not for human or veterinary use. Not for diagnostic, therapeutic, clinical, cosmetic, or household applications.