Tesamorelin

Description

Product Specifications

Form: Lyophilized peptide powder

Strength: Add the product-specific strength

Peptide Length: 44 amino acid residues

Peptide Classification: Synthetic modified human GRF analog research peptide

Peptide Sequence: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH₂

One-Letter Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH₂

N-Terminal Modification: Trans-3-hexenoyl group attached to the N-terminal tyrosine residue

C-Terminal Modification: Amidated

Molecular Formula: C₂₂₁H₃₆₆N₇₂O₆₇S for Tesamorelin free base

Molecular Weight: Approximately 5135.9 g/mol for the free-base equivalent

CAS Number: 218949-48-5

Purity: ≥99%, where confirmed through batch-specific HPLC analysis

Appearance: White to off-white lyophilized peptide powder

Intended Use: Laboratory research and analytical applications only

Research Applications

Analytical characterization using HPLC, UPLC, and LC-MS workflows

In vitro investigation of human GRF receptor-binding behavior

Evaluation of peptide-mediated intracellular signaling under controlled assay conditions

Structure-activity analysis of modified GRF peptide sequences

Characterization of the N-terminal hexenoyl modification

Comparative assessment of Tesamorelin and related GRF-derived research peptides

Peptide identity, purity, molecular weight, and structural integrity analysis

Investigation of ligand-receptor interactions in defined experimental systems

Stability profiling under controlled temperature, pH, buffer, and storage conditions

Quality Documentation

A batch-specific Certificate of Analysis and applicable analytical documentation should be available for each lot. Verify peptide identity, exact 44-residue sequence, N-terminal hexenoyl modification, C-terminal amidation, purity, molecular weight, counterion content, formulation details, and batch information against the records supplied with the individual product.

Tesamorelin is commonly prepared as an acetate salt. FDA documentation lists Tesamorelin acetate as C₂₂₁H₃₆₆N₇₂O₆₇S · xC₂H₄O₂, where acetate content varies and x ≈ 7 in the referenced formulation. The reported 5135.9 Da molecular weight corresponds to the free-base equivalent, not the complete variable-acetate preparation.

Because acetate content can vary, do not assign a single fixed molecular weight to the complete salt preparation without batch-specific analytical data. HPLC, mass spectrometry, and applicable counterion analysis should be used as the final reference for product specifications.

For Laboratory Research Use Only

This product is intended exclusively for controlled laboratory and in vitro research. Not for human or veterinary use. Not for diagnostic, therapeutic, clinical, cosmetic, or household applications.